CLUSTAL W (1.74) multiple sequence alignment


AT1G27360 ------------------------------------------------------------
AT1G27370 ------------------------------------------------------------
AT5G50570 ------------------------------------------------------------
AT1G69170 ------------------------------------------------------------
AT2G33810 ------------------------------------------------------------
AT1G53160 ------------------------------------------------------------
AT3G15270 ------------------------------------------------------------
AT2G42200 ------------------------------------------------------------
AT3G57920 ------------------------------------------------------------
AT1G20980 MDEVGAQVAAPMFIHQSLGRKRDLYYPMSNRLVQSQPQRRDEWNSKMWDWDSRRFEAKPV
AT1G76580 ------------------------------------------------------------
AT2G47070 ------------------------------------------------------------
AT3G60030 ------------------------------------------------------------
AT1G02065 ------------------------------------------------------------
AT5G43270 ------------------------------------------------------------
AT5G18830 ------------------------------------------------------------


AT1G27360 --------------------------------------MDCNMVSSSQWDWEHLIMSNPS
AT1G27370 --------------------------------------MDCNMVSSFPWDWENLIMSNQS
AT5G50570 ------------------------------------------------------------
AT1G69170 --------------------------------------------MDSWSYGRSVFMSNET
AT2G33810 ------------------------------------------------------------
AT1G53160 ------------------------------------------------------------
AT3G15270 ------------------------------------------------------------
AT2G42200 ------------------------------------------------------------
AT3G57920 ------------------------------------------------------------
AT1G20980 DVEVQEFDLTLRNRSGEERGLDLNLGSGLTAVEETTTTTQNVRPNKKVRSGSPGGNYPMC
AT1G76580 ------------------------------------------------------------
AT2G47070 -----------------------------------------------MEARIDEGGE-AQ
AT3G60030 -----------------------------------------------MEARIEGEVEGHS
AT1G02065 ------------------------------------------MLDYEWDNPSSIVLSGDE
AT5G43270 --------------------------------------MECNAKPPFQWELENLISFGTS
AT5G18830 ----------------------------------------MSSLSQSPPPPEMDIQPPAL


AT1G27360 RTEDDSKQLPTEWEIEKGEGIESIVPHFSGLERVSSGSATSFWHTAVSKSSQSTSINSSS
AT1G27370 KTENEKKQQSTEWEFEKGEGIESIVPDFLGFEKVSSGSATSFWHTAVSKSSQSTSINSSS
AT5G50570 ----------MDWNFKLSSGYLSGFDQEPDLSPMDG--SISFG---G--SSQSKADFSFD
AT1G69170 LLPCDTFAKNRRFEQRLSNNDDVLISDMAGNSNGFSAVSITKV---VPEEEDEENISSSS
AT2G33810 ---------------------------------------------------------MSM
AT1G53160 ----------------------------------MEGKRSQG---------QGYMKKK--
AT3G15270 ----------------------------------MEGQRTQR---------RGYLKDKA-
AT2G42200 ----------------------------------MEMGSNSGP---GHGPGQAESGGSS-
AT3G57920 ----------------------------------MELLMCSG---------QAESGGSSS
AT1G20980 QVDNCTEDLSHAKDYHRRHKVCEVHSKATKALVGKQMQRFCQQCSRFHLLSEFDEGKRSC
AT1G76580 ------------------------------------------------------------
AT2G47070 QFYGSVGKRSVEWDLN-DWKWDGDLFLATQTTRGRQF--FPLGNSSNSSSSCSDEGN---
AT3G60030 LEYGFSGKRSVEWDLN-DWKWNGDLFVATQLNHG----------SSNSSSTCSDEGNVEI
AT1G02065 RNPDSDPTRSSFSFFDPISHYNNDHRHITISPPLLSSFSNQQQQHHLTLYGQTNSNNQFL
AT5G43270 TAEVPRKLKPMEWEIDGFDCTSLYSSSFAYAGSSGSDIAHAFSKSSKSTSISSSSAEVRT
AT5G18830 VNDDPSTYSSALWDWGDLLDFAADERLLVDQIHFPPVLSPPLPPLIPTQTPAESELDPSP


AT1G27360 PEAKRCKLASESSPGDSCSNIDFVQVKAPTALEVSVASAESDLCLKLGKRTYSEEYWGRN
AT1G27370 PEDKRCNLASQSSPGDSSSNIDFLQVKPSTALEVPIASAESDLCLKLGKRTYSEEFWGRN
AT5G50570 LKLGRNIGNSSSVFGDTEQVISLSKWKD------------SALAKPEGSRSSSSK-RTRG
AT1G69170 KF-------SSQELNRIDFKLRSFLDLGN------------DDD--DTSSRGFAL-PSKK
AT2G33810 RR-------SKAEGKRSLRELSEEEEEEE------------ETE--DEDTFEEEE-ALEK
AT1G53160 ---------SYLVEEDMETDTDEEEEVGR------------D--------------RVRG
AT3G15270 TV-------SNLVEEEMENGMDGEEEDGG------------DED----KRKKVME-RVRG
AT2G42200 TE-------SSSFSGGLMFGQKIYFEDGG------------GGSGSSSSGGRSNR-RVRG
AT3G57920 TE-------SSSLSGGLRFGQKIYFEDG--------------------SGSRSKN-RVN-
AT1G20980 RRRLAGHNRRRRKTTQPEEVASGVVVPGNHDTTNNTANANMDLMALLTALACAQ---GKN
AT1G76580 ----------------------------------------MDVMALLTALVCAQ---GRN
AT2G47070 -----------------DKKRRAVAIQG-------------DTNGALTLNLNGESDGLFP
AT3G60030 ME-------RRRIEMEKKKKRRAVTVVAMEED-----NLKDDDAHRLTLNLGGNNIEGNG
AT1G02065 HHHHHHHSLYGSTTTTTPYGASDPIYHPHSSAPPASLFSYDQTGPGSGSGSSYNFLIPKT
AT5G43270 HN--FTSETGESLPGEFAKGIDTSPSLELSFG-----SGDPVLGLKLGKRTYFEDFWEVE
AT5G18830 EE--SG-SGSDRVRKRDPRLICSNFIEGMLP------CSCPELDQKLEDAELPKKKRVRG


AT1G27360 NNEISAVSMKLLTP----------------SVVAGK-SKLCGQSMPVPRCQIDGCELDLS
AT1G27370 NNDLSAVSMNLLTP----------------SVVARKKTKSCGQSMQVPRCQIDGCELDLS
AT5G50570 NG-VG-------------------------------------T-NQMPICLVDGCDSDFS
AT1G69170 SR-------------------------------------ASNLCSQNPLCQVYGCSKDLS
AT2G33810 KQ-------------------------------------KGKATSSSGVCQVESCTADMS
AT1G53160 SR------------------------------------GSINRGGSLRLCQVDRCTADMK
AT3G15270 P--------------------------------------STDRVPS-RLCQVDRCTVNLT
AT2G42200 G--------------------------------------GSGQSGQIPRCQVEGCGMDLT
AT3G57920 ---------------------------------------TVRKSSTTARCQVEGCRMDLS
AT1G20980 AVKPP---------------------------------VGSP-----AVPDREQLLQILN
AT1G76580 EATT----------------------------------NGSP-----GVPQREQLLQILN
AT2G47070 AKKTK---------------------------------SG-------AVCQVENCEADLS
AT3G60030 VKKTK---------------------------------LGGGIPSRAICCQVDNCGADLS
AT1G02065 EVDFTSNRIGLNLGGRTYFSAADDDFVSRLYRRSRPGESGMANSLSTPRCQAEGCNADLS
AT5G43270 NAKGLGLPVTLASS----------------SVSPVKKSKSIPQRLQTPHCQVEGCNLDLS
AT5G18830 ---------------------------------------G----SGVARCQVPDCEADIS
:.

AT1G27360 SAKGYHRKHKVCEKHSKCPKVSVSGLERRFCQQCSRFHAVSEFDEKK-RSCRKRLSHHNA
AT1G27370 SSKDYHRKHRVCETHSKCPKVVVSGLERRFCQQCSRFHAVSEFDEKK-RSCRKRLSHHNA
AT5G50570 NCREYHKRHKVCDVHSKTPVVTINGHKQRFCQQCSRFHALEEFDEGK-RSCRKRLDGHNR
AT1G69170 SSKDYHKRHRVCEAHSKTSVVIVNGLEQRFCQQCSRFHFLSEFDDGK-RSCRRRLAGHNE
AT2G33810 KAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEFDEAK-RSCRRRLAGHNE
AT1G53160 EAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDLQEFDEAK-RSCRRRLAGHNE
AT3G15270 EAKQYYRRHRVCEVHAKASAATVAGVRQRFCQQCSRFHELPEFDEAK-RSCRRRLAGHNE
AT2G42200 NAKGYYSRHRVCGVHSKTPKVTVAGIEQRFCQQCSRFHQLPEFDLEK-RSCRRRLAGHNE
AT3G57920 NVKAYYSRHKVCCIHSKSSKVIVSGLHQRFCQQCSRFHQLSEFDLEK-RSCRRRLACHNE
AT1G20980 KINALPLP---MDLVSKLNN--IGSLARKNMDHP-TVNPQNDMNGAS-PSTMDLLAVLST
AT1G76580 KIKALPLP---MNLTSKLNN--IGILARKNPEQPSPMNPQNSMNGASSPSTMDLLAALSA
AT2G47070 KVKDYHRRHKVCEMHSKATSATVGGILQRFCQQCSRFHLLQEFDEGK-RSCRRRLAGHNK
AT3G60030 KVKDYHRRHKVCEIHSKATTALVGGIMQRFCQQCSRFHVLEEFDEGK-RSCRRRLAGHNK
AT1G02065 HAKHYHRRHKVCEFHSKASTVVAAGLSQRFCQQCSRFHLLSEFDNGK-RSCRKRLADHNR
AT5G43270 SAKDYHRKHRICENHSKFPKVVVSGVERRFCQQCSRFHCLSEFDEKK-RSCRRRLSDHNA
AT5G18830 ELKGYHKRHRVCLRCATASFVVLDGENKRYCQQCGKFHLLPDFDEGK-RSCRRKLERHNN
. :. :: :: .: .:: . * * .

AT1G27360 RRRKPQGV----F---SMNPERVYDRRQHTNMLWNG--------VSLNARSEEMYEWGNN
AT1G27370 RRRKPQGV----F---PLNSERVFDRRQHTSMLWNG--------LSLNTRSEEKYTWG-T
AT5G50570 RRRKPQPE----H---IGRPANFFTGFQGSKLLEFSGG-----SHVFPTTSVLNPSWGNS
AT1G69170 RRRKPAFYFLPGK---RHKLLRTSQDVVGNKFLENSSL-----VLPESFPGSLLYRVIDE
AT2G33810 RRRKSTTD----------------------------------------------------
AT1G53160 RRRKSSG--------------ESTYGEGSGRRGINGQV-----VMQNQERSRVEMTLPMP
AT3G15270 RRRKISG--------------DS-FGEGSGRRGFSGQL-----I-QTQERNRVDRKLPMT
AT2G42200 RRRKPQPA--------SLSVLASRYGRIAPSLYENGDA-----GMNGSFLGNQEIGWPSS
AT3G57920 RRRKPQP---------TTALFTSHYSRIAPSLYGNPNA-----AMIKSVLG-DPTAWSTA
AT1G20980 TLGSSSPDALAIL---SQGGFGNKDS-EKTKLSSYENG------VTTNLEKRTF-GFSSV
AT1G76580 SLGSSAPEAIAFL---SQGGFGNKESNDRTKLTSSDHS------ATTSLEKKTL-EFPSF
AT2G47070 RRRKTNPEPGANG-NPSDDHSSNYLLITLLKILSNMHN----HTGDQDLMSHLLKSLVSH
AT3G60030 RRRKANPDTIGNGTSMSDDQTSNYMLITLLKILSNIHSNQSDQTGDQDLLSHLLKSLVSQ
AT1G02065 RRRKCHQS--------ASATQDTGTGKTTPKSPNDSGVK---ASSSPSSNAPPTISLECF
AT5G43270 RRRKPNPG-------------RTYDGKPQVDFVWNR-------FALIHPRSEEKFIWPSS
AT5G18830 RRKRKPVDKGG-----VAAEQQQVLSQNDNSVIDVEDGK--DITCSSDQRAEEEPSLIFE


AT1G27360 TYDTKPRQTEKS----FTLSFQRGNGS---------EDQLVASSSRMFSTS-----QTSG
AT1G27370 TYETKPTQMESG----FTLSFQRGNGS---------EDQLFTGSTLSFSAF-----QTSG
AT5G50570 LVSVAVAANGSS----YGQSQSYVVGS---------SPAKTGIMFPISSSP-----NSTR
AT1G69170 DDHRTSRLVSFKDEPTCSMFPTNEQNS---------SRTYESKPAIYSTEV-----SSIW
AT2G33810 ------------------------------------------------------------
AT1G53160 NS----SFKRPQ------IR----------------------------------------
AT3G15270 NS----SFKRPQ------IR----------------------------------------
AT2G42200 RTLDTRVMRRPVSSPSWQINPMNVFS-----------QGSVGGGGTSFSS------PEIM
AT3G57920 RS----VMQRPG--P-WQINPVRETHP---------HMNVLSHGSSSFTTC-----PEMI
AT1G20980 GG-ERSSSSNQSPSQDSDSRGQDTRSS-LSLQLFTSSPEDESRPTVASSRK----YYSSA
AT1G76580 GGGERTSSTNHSPSQYSDSRGQDTRSS-LSLQLFTSSPEEESRPKVASSTK----YYSSA
AT2G47070 AGEQLGKNLVELLLQGGGSQGSLNIGN-SALLGIEQAPQEELKQFSARQD-------GTA
AT3G60030 AGEHIGRNLVGLLQGGGGLQASQNIGNLSALLSLEQAPREDIKHHSVSETPWQEVYANSA
AT1G02065 RQRQFQTTASSSTSASSSSNSMFFSSG---------------------------------
AT5G43270 KHVPSRVLMPQPAKTEISDTEHNRFG--------LLDPKTKTARAELFSKEKVTISSHMG
AT5G18830 DRHITTQGSVPFTRSINADNFVSVTGS-------GEAQPDEGMNDTKFERS-----PSNG


AT1G27360 G------FPAGKSKFQLHGED---VGEYSGVLHESQD------IHRALSLLSTSS-----
AT1G27370 G------FSAGKSNIQLPDKG---VGECSGGLHESHD------FYSALSLLSTTS-----
AT5G50570 S------IAKQFPFLQEEESSR-TASLCERMTSCIHD------SDCALSLLSSSS-----
AT1G69170 D---LHETAASRSTRALSLLSA-QSQQHLSKFPNTTFS-----ITQPNQNLNHSS-----
AT2G33810 ------------------------------------------------------------
AT1G53160 ------------------------------------------------------------
AT3G15270 ------------------------------------------------------------
AT2G42200 DTKLESYKGIGDSNCALSLLSN-PHQPHDNNNNNNNNNNNNNNTWRASSGFGPMT-----
AT3G57920 N------NNSTDSSCALSLLSN-SYPIHQQQLQTPTN------TWRPSSGFDSMISFSDK
AT1G20980 SSNPVEDRSPSSSPVMQELFPL-QASPETMRSKNHKNS--SPRTGCLPLELFGASNRG--
AT1G76580 SSNPVEDRSPSSSPVMQELFPL-HTSPETRRYNNYKDTSTSPRTSCLPLELFGASNRGA-
AT2G47070 TE----NRSEKQ--VKMNDFDLNDIYIDSDD-TDVERS--PPPTNPATSSLDYPSWIH--
AT3G60030 QERVAPDRSEKQ--VKVNDFDLNDIYIDSDDTTDIERSS-PPPTNPATSSLDYHQDSR--
AT1G02065 ------------------------------------------------------------
AT5G43270 ASQDLDGALSLLSNSTTWVSSSDQPRRFTLDHHPSSN--LQPVAHRSAAQLNSVSG----
AT5G18830 DNKSAYSTVCPTGRISFKLYDWNPAEFPRRLRHQIFQ----WLANMPVELEGYIRPGCTI


AT1G27360 ---------------DPLAQPHVQPFSL------LCSYD---------------------
AT1G27370 ---------------DSQGIKHTPVAEP------PPIFG---------------------
AT5G50570 ---------------SSVPHLLQPPLSLSQE-AVETVFYGSGLFENASAVSDGSVISGNE
AT1G69170 ---------------STDYHQMEQPLWIDPG-KTNSAGSSSCKGKGTSTVDLLQLSS---
AT2G33810 ------------------------------------------------------------
AT1G53160 ------------------------------------------------------------
AT3G15270 ------------------------------------------------------------
AT2G42200 VTMAQPP-------PAPSQHQYLNPPWVFKD-NDNDMSPVLN-LGRYTEPDNCQISSGTA
AT3G57920 VTMAQPPPISTHQPPISTHQQYLSQTWEVIA-GEKSNSHYMSPVSQISEPADFQISNGTT
AT1G20980 -AADPNFKGFGQQSGYASSGSDYSPPSLNSD-AQDRTGKIVFKLLDKDPSQLPGTLRSEI
AT1G76580 -TANPNYNVLRHQSGYASSGSDYSPPSLNSN-AQERTGKISFKLFEKDPSQLPNTLRTEI
AT2G47070 -QSSPPQTSR-----NSDSASDQSPSSSSED-AQMRTGRIVFKLFGKEPNEFPIVLRGQI
AT3G60030 -QSSPPQTSRR----NSDSASDQSPSSSSGD-AQSRTDRIVFKLFGKEPNDFPVALRGQI
AT1G02065 ------------------------------------------------------------
AT5G43270 -------------YWQPDPPAVEGPTALHRN-GVGQFNENYFSLNQFYN-----------
AT5G18830 LTVFIAMPEIMWAKLSKDPVAYLDEFILKPGKMLFGRGSMTVYLNNMIFRLIKGGTTLKR


AT1G27360 ------------VVPK--------------------------------------------
AT1G27370 ------------TFPSHFI-----------------------------------------
AT5G50570 AV------RLPQTFPFHWE-----------------------------------------
AT1G69170 ---------HLQRIEQQRNYTGDVKQEYNELYFPGS------------------------
AT2G33810 ------------------------------------------------------------
AT1G53160 ------------------------------------------------------------
AT3G15270 ------------------------------------------------------------
AT2G42200 MGEFELSDHHHQSRRQYMEDENTRAYDSSSHHTNWSL-----------------------
AT3G57920 MGGFELY-LHQQVLKQYMEPENTRAYDSSPQHFNWSL-----------------------
AT1G20980 YNWLSNIPSEMESYIRPGCVVLSVYVAMSPAAWEQLEQKLLQRLGVLLQNSPSDFWRNAR
AT1G76580 FRWLSSFPSDMESFIRPGCVILSVYVAMSASAWEQLEENLLQRVRSLVQDS--EFWSNSR
AT2G47070 LDWLSHSPTDMESYIRPGCIVLTIYLRQAETAWEELSDDLGFSLGKLLDLSDDPLWTTGW
AT3G60030 LNWLAHTPTDMESYIRPGCIVLTIYLRQDEASWEELCCDLSFSLRRLLDLSDDPLWTDGW
AT1G02065 ------------------------------------------------------------
AT5G43270 ------------------------------------------------------------
AT5G18830 VDVKLESPKLQFVYPTCFEAGKPIELVVCGQNLLQPKCRFLVSFSGKYLPHNYSVVPAPD


AT1G27360 ------------------------------------------------------------
AT1G27370 ------------------------------------------------------------
AT5G50570 ------------------------------------------------------------
AT1G69170 ------------------------------------------------------------
AT2G33810 ------------------------------------------------------------
AT1G53160 ------------------------------------------------------------
AT3G15270 ------------------------------------------------------------
AT2G42200 ------------------------------------------------------------
AT3G57920 ------------------------------------------------------------
AT1G20980 FIVNTGRQLASHKNGKVRCSKS--WRTWNSPELISVSPVAVVAGEETSLVVRGRSLTNDG
AT1G76580 FLVNAGRQLASHKHGRIRLSKS--WRTLNLPELITVSPLAVVAGEETALIVRGRNLTNDG
AT2G47070 IYVRVQNQLAFVYNGQVVVDTSLSLKSRDYSHIISVKPLAIAATEKAQFTVKGMNLRQRG
AT3G60030 LYLRVQNQLAFAFNGQVVLDTSLPLRSHDYSQIITVRPLAV--TKKAQFTVKGINLRRPG
AT1G02065 ------------------------------------------------------------
AT5G43270 ------------------------------------------------------------
AT5G18830 QDGKRSCNNKFYKINIVNSDPSLFGPAFVEVENESGLSNFIPLIIGDAAVCSEMKLIEQK


AT1G27360 ------------------------------------------------------------
AT1G27370 ------------------------------------------------------------
AT5G50570 ------------------------------------------------------------
AT1G69170 ------------------------------------------------------------
AT2G33810 ------------------------------------------------------------
AT1G53160 ------------------------------------------------------------
AT3G15270 ------------------------------------------------------------
AT2G42200 ------------------------------------------------------------
AT3G57920 ------------------------------------------------------------
AT1G20980 ISIRCTHMGSYMAMEVTRAV---CRQTIFDELN-VNSFKVQNVHPGFLGRCFIEVENGF-
AT1G76580 MRLRCAHMGNYASMEVTGRE---HRLTKVDELN-VSSFQVQSASSVSLGRCFIEPMPRF-
AT2G47070 TRLLCSVEGKYLIQETTHDSTTREDDDFKDNSEIVECVNFSCDMPILSGRGFMEIEDQG-
AT3G60030 TRLLCTVEGTHLVQEATQGG-MEERDDLKENNE-IDFVNFSCEMPIASGRGFMEIEDQGG
AT1G02065 ------------------------------------------------------------
AT5G43270 ------------------------------------------------------------
AT5G18830 FNATLFPEGQEVTACSSLTCCCRDFGERQSTFSGLLLDIAWSVKVPSAERTEQPVNRCQI


AT1G27360 ------------------------------------------------------------
AT1G27370 ------------------------------------------------------------
AT5G50570 ------------------------------------------------------------
AT1G69170 ------------------------------------------------------------
AT2G33810 ------------------------------------------------------------
AT1G53160 ------------------------------------------------------------
AT3G15270 ------------------------------------------------------------
AT2G42200 ------------------------------------------------------------
AT3G57920 ------------------------------------------------------------
AT1G20980 -RGDSFPLIIAN-ASICKELNRLGEEFHPKSQDMTEEQAQSSNRGPTSREEVLCFLNELG
AT1G76580 -AKS--------------------------------------------------------
AT2G47070 LSSSFFPFLVVEDDDVCSEIRIL------------E--TTLEFTGTDSAKQAMDFIHEIG
AT3G60030 LSSSFFPFIVSEDEDICSEIRRL------------E--STLEFTGTDSAMQAMDFIHEIG
AT1G02065 ------------------------------------------------------------
AT5G43270 ------------------------------------------------------------
AT5G18830 KRYNRVLNYLIQNNSASILGNVLHN---LETLVKKMEPDSLVHCTCDCDVRLLHENMDLA


AT1G27360 ------------------------------------------------------------
AT1G27370 ------------------------------------------------------------
AT5G50570 ------------------------------------------------------------
AT1G69170 ------------------------------------------------------------
AT2G33810 ------------------------------------------------------------
AT1G53160 ------------------------------------------------------------
AT3G15270 ------------------------------------------------------------
AT2G42200 ------------------------------------------------------------
AT3G57920 ------------------------------------------------------------
AT1G20980 WLFQKN------QTSELREQSDFSLARFKFLLVCSVERDYCALIRTLLDMLVERNLVNDE
AT1G76580 ------------------------------------------------------------
AT2G47070 WLLHR----SKLGESDPNP-GVFPLIRFQWLIEFSMDREWCAVIRKLLNMFFDG--AVGE
AT3G60030 WLLHRSELKSRLAASDHNPEDLFSLIRFKFLIEFSMDREWCCVMKKLLNILFE----EGT
AT1G02065 ------------------------------------------------------------
AT5G43270 ------------------------------------------------------------
AT5G18830 SDIHRKHQSPIESKVNPPSSGCCCVSSQKDIPSRILNFNKDPEAGLDCKERIQADCSPDS


AT1G27360 ------------------------------------------------------------
AT1G27370 ------------------------------------------------------------
AT5G50570 ------------------------------------------------------------
AT1G69170 ------------------------------------------------------------
AT2G33810 ------------------------------------------------------------
AT1G53160 ------------------------------------------------------------
AT3G15270 ------------------------------------------------------------
AT2G42200 ------------------------------------------------------------
AT3G57920 ------------------------------------------------------------
AT1G20980 LNREALDMLAEIQLLNRAVKRKSTKMVELLIHYLVNPLTLSSSRKFVFLPNITGPGGITP
AT1G76580 ------------------------------------------------------------
AT2G47070 FSSSSNATLSELCLLHRAVRKNSKPMVEMLLR--YIPKQQRN---SLFRPDAAGPAGLTP
AT3G60030 VDPSPDAALSELCLLHRAVRKNSKPMVEMLLR--FSPKKKNQTLAGLFRPDAAGPGGLTP
AT1G02065 ------------------------------------------------------------
AT5G43270 ------------------------------------------------------------
AT5G18830 GGKETDPLLNKEVVMN-VNDIGDWPRKSCIKTHSALAFRSRQTMFLIATFAVCFAVCAVL


AT1G27360 ------------------------------------------------------------
AT1G27370 ------------------------------------------------------------
AT5G50570 ------------------------------------------------------------
AT1G69170 ------------------------------------------------------------
AT2G33810 ------------------------------------------------------------
AT1G53160 ------------------------------------------------------------
AT3G15270 ------------------------------------------------------------
AT2G42200 ------------------------------------------------------------
AT3G57920 ------------------------------------------------------------
AT1G20980 LHLAACTSGSDDMIDLLTNDPQEIGLSSWNTLRDATGQTPYSYAAIRNNHNYNSLVARKL
AT1G76580 ------------------------------------------------------------
AT2G47070 LHIAAGKDGSEDVLDALTEDPAMVGIEAWKTCRDSTGFTPEDYARLRGHFSYIHLIQRKI
AT3G60030 LHIAAGKDGSEDVLDALTEDPGMTGIQAWKNSRDNTGFTPEDYARLRGHFSYIHLVQRKL
AT1G02065 ------------------------------------------------------------
AT5G43270 ------------------------------------------------------------
AT5G18830 YHPNKVTQLAVAIRMRLVHKI---------------------------------------


AT1G27360 ------------------------------------------------------------
AT1G27370 ------------------------------------------------------------
AT5G50570 ------------------------------------------------------------
AT1G69170 ------------------------------------------------------------
AT2G33810 ------------------------------------------------------------
AT1G53160 ------------------------------------------------------------
AT3G15270 ------------------------------------------------------------
AT2G42200 ------------------------------------------------------------
AT3G57920 ------------------------------------------------------------
AT1G20980 ADK--RNKQVSLNIEHEVVDQTGLSKRLSLEMNKSSSSCAS--CATVALKYQRRVSGSQR
AT1G76580 ------------------------------------------------------------
AT2G47070 NKKSTTEDHVVVNIPVSFSDREQKEPKSGPMAS-ALEITQI-PCKLCDHKLVYGTTR-RS
AT3G60030 SRKPIAKEHVVVNIPESFN-IEHKQEKRSPMDSSSLEITQINQCKLCDHKRVFVTTHHKS
AT1G02065 ------------------------------------------------------------
AT5G43270 ------------------------------------------------------------
AT5G18830 ------------------------------------------------------------


AT1G27360 -----------------------------------------------
AT1G27370 -----------------------------------------------
AT5G50570 -----------------------------------------------
AT1G69170 -----------------------------------------------
AT2G33810 -----------------------------------------------
AT1G53160 -----------------------------------------------
AT3G15270 -----------------------------------------------
AT2G42200 -----------------------------------------------
AT3G57920 -----------------------------------------------
AT1G20980 LFPTPIIHSMLAVATVCVCVCVFMHAFPIVRQGSH-FSWGGLDYGSI
AT1G76580 -----------------------------------------------
AT2G47070 VAYRPAMLSMVAIAAVCVCVALLFKSCPEVLYVFQPFRWELLDYGTS
AT3G60030 VAYRPAMLSMVAIAAVCVCVALLFKSCPEVLYVFQPFRWELLEYGTS
AT1G02065 -----------------------------------------------
AT5G43270 -----------------------------------------------
AT5G18830 -----------------------------------------------