CLUSTAL W (1.74) multiple sequence alignment


AT1G30810.1 ------------------------------------------------MENPPLESEIKE
AT2G34880.1 ------------------------------------------------ME-PFSAAQNKE
AT4G20400.1 ------------------------------------------------MD---QLASLAE
AT1G08620.1 MGTELMRICVKEDSDDLPSVPPGFESYATFTLKRVVPATTSDKAKTPAIESVSATEQAKM
AT2G38950.1 MGIEGVSTYLKSGNMDTISAPPGFVSQTSFVLR-NVPRDKESPRSVSRQE--QTTGFGTD
:

AT1G30810.1 DMSLKNHPPDK------DKDKDTIMEQPSSPRHRKVVARWLPDEAQ--RPIINDAPVF--
AT2G34880.1 DKDTSVEPPRRRCH---RKNKGTNVEPPSSPYHPKVLARWDPANEK--RPDIGEAPVF--
AT4G20400.1 SVAMEEDSEKQ------SIKGESSLEPDSTPSSPKITARWNPSEAC--RPLVDDAPIF--
AT1G08620.1 EVESDEAKAARALRRRPWINHSGCDDDGDCAANNDNAASQNPDQNCDVKPALPKGVVRGC
AT2G38950.1 DKDSCNMFLKSRP----WIVHGHTIPSSEALRPKKTEVRRRRPLKVSETKVLEEAPVF--
. . . . : .. :

AT1G30810.1 ---TPSLEEFVDPLAYIEKIRPLAEPYGICRIIPPSTWKPPCRLKEKSIWEQTKFPTRIQ
AT2G34880.1 ---HPTSEEFEDTLAYIEKIRPLAESFGICRIVPPSNWSPPCRLKGDSIWKNKNFPTRVQ
AT4G20400.1 ---YPTNEDFDDPLGYIEKLRSKAESYGICRIVPPVAWRPPCPLKEKKIWENSKFPTRIQ
AT1G08620.1 EECKDCQKEFEDTLNYIAKIRPEAEKYGICRIVPPPSWKPPCPLKEKQVWEGSKFTTRVQ
AT2G38950.1 ---NPTEEEFRDTLSYISSLRDRAEPYGICCVVPPPSWKPPCLLKEKQIWEASTFFPQVQ
::* *.* ** .:* ** :*** ::** * *** ** ..:*: ..* .::*

AT1G30810.1 TVDLLQNREPMKKK---PKSRKRKRRRNSRMGSSKRRSGSSPAESTSSPEA--EEKFGFN
AT2G34880.1 FVDLLQNRGPVKKKT--PKGRKRKRGKYSRTVAPKKRNGS-VSKSVSTPKATEEENFGFE
AT4G20400.1 FIDLLQNREPIKKS---TKTKKRKRRRISKIGYTRRKRDS-GCDTASSGSSDSEGKFGFQ
AT1G08620.1 RVDKLQNRSSMKKISKLPNQMRKKKRKCMKMGMDSVTNGMGDPCSASTGMN-ELETFGFE
AT2G38950.1 LFGIQTENRKIKKE---------------------VDADS--NDAASEGVQ--LC--RVE
.. :. :** . :.* .:

AT1G30810.1 SGSDFTLDEFEKYALHFKDSYFEKKDSGGDIV--------KWTPSVDDIEGEYWRIVEQP
AT2G34880.1 SGPEFTLEKFEKYAQDFKDSYFERKDNVGD-------------PSVEEIEGEYWRIIEKE
AT4G20400.1 TGPDFTLEEFQKYDEYFKECYFQSEDHPGSKASENK----KFKPKVKDLEGEYWRIVEQA
AT1G08620.1 PGPGFTLKDFQKYADEFKAQYFKKSETSTDDKCKVDNSIDCWEPALEDVEGEYWRIVDKA
AT2G38950.1 RGPGYTLKSFKNFADTYKKSHFGMKDEVLGSENSSP-SLKPNELIVADIEKEYRQIVESP
*. :**..*::: :* :* .: . : ::* ** :*::.

AT1G30810.1 TDEVEVYYGADLENGVLGSGFYKRAEKFTG-SDMEQYTLSGWNLNNLPRLPGSVLSFEDC
AT2G34880.1 TNEVKVLYGTDLENPILGSGFSKGVKIPTRRNDMDKYISSGWNLNNLARLQGSLLSFEDC
AT4G20400.1 TDEVEVYYGADLETKKFGSGFPKYKPGYPI-SEADQYSQCGWNLNNLSRLPGSVLAFESC
AT1G08620.1 TEEIEVLYGADLETGVFGSGFPKISSSHNASSSEDKYAKSGWNLNNFPRLPGSLLKYEGS
AT2G38950.1 LIEIGVLYGNDLDTATFGSGFPLSAPSESS-----KYSS-GWNLNSTAKLPGSLLSLEDC
*: * ** **:. :**** :* *****. .:* **:* *..

AT1G30810.1 DISGVLVPWLYVGMCFSSFCWHVEDHHLYSLNYHHFGEPKVWYGVPGSNATALEKAMRKH
AT2G34880.1 EISGVQVPWLYVGMCFSTFCWHVEDNHLYSLNYHHFGEPKVWYGVPGSHATGLEKAMRKH
AT4G20400.1 DISGVIVPWLYVGMCFSTFCWHVEDHHLYSMNYLHTGDPKVWYGIPGNHAESFENVMKKR
AT1G08620.1 DISGVLVPWLYIGMCFSSFCWHVEDHHLYSLNYMHWGAPKLWYGVGGKDAVKLEEAMRKH
AT2G38950.1 ES--VCVPRLSVGMCLSSQFWKSEKERLYSLCYLHVGAPRVWYSVAGCHRSKFKAAMKSF
: * ** * :***:*: *: *..:***: * * * *::**.: * . :: .*:.

AT1G30810.1 LPDLFEDS------LI------------------------YYMAW--AYHAGFNCGFNCA
AT2G34880.1 LPDLFDEQPDLLHELVTQFSPTILKNEGVPVYRAVQNAGEYVLTFPRAYHSGFNCGFNCA
AT4G20400.1 LPDLFEEQPDLLHQLVTQLSPRILKEEGVPVYRAVQRSGEFILTFPKAYHSGFNCGFNCA
AT1G08620.1 LPDLFEEQPDLLHKLVTQLSPSKLKTAGVPVHRCVQHAGEFVLTFPRAYHAGFNSGFNCA
AT2G38950.1 ILEMSGEQPKKSHNPVMMMSPYQLSVEGIPVTRCVQHPGQYVIIFPGSYYSAFDCGFNCL
: :: :. : : : : :*::.*:.****

AT1G30810.1 EAVNVAPVDWLAHGQNAVELYSKETRKTSLSHDKLLLGAAYEAVKALWELSASEGKENTT
AT2G34880.1 EAVNVAPVDWLAHGQNAVEIYSQETRKTSLSHDKILLGAAFEAVKS---LSA-HGEDNTK
AT4G20400.1 EAVNVAPVDWLVHGQNAVEGYSKQRRKSSLSHDKLLLGAAMEATYCLWELSL-SKKKTPV
AT1G08620.1 EAVNVAPVDWLPHGQIAIELYCQQGRKTSISHDKLLLGAAREVVKADWELNL-LRKNTVD
AT2G38950.1 EKANFAPLDWLPHGDIAVQVNQEMSKTSLISYDKLLFSAAREAVKCLKEYGL-SKKNTAC
* .*.**:*** **: *:: : :.: :*:**:*:.** *.. . . :..

AT1G30810.1 NLRWKSFCGKNGTLTNAIQARLQMEEGRITALGRDSSSLKKMEKDFDSNCERECFSCFYD
AT2G34880.1 RFSWKRFCGKDGIITKAIEARLRMEEKRIEALG-NGFSLVKMDKDFDSNCERECISCFSD
AT4G20400.1 IARWKRVCSEDGLLTKAVKKRVQMEEERLNHLQ-DGFSLRKMEGDFDNKRERECFLCFYD
AT1G08620.1 NLRWKAFSAKDGILAKTLKARIDMERTRREFLC-NSSLALKMHSNFDATNERECCICFFD
AT2G38950.1 YTRWNDSCGTDGLFSNIIKSRIKLEKNRREFLI-SSLESQRMDKSYDAVNKRECCVCLGD
*: .. :* ::: :: *: :*. * * .. :*. .:* :*** *: *

AT1G30810.1 LHLSASGCK-CSP-EEYACLKHADDLCSCDVKDGFILLRYTMDELSSLVRALEGE-SDDL
AT2G34880.1 LHLSATGCKNCSSLEEYGCTKH--DICSCEGKDRFIFLRYTIDELSSLVRALEGE-SDDL
AT4G20400.1 LHMSASSCK-CSP-NRFACLIHAKDLCSCESKDRYILIRHTLDELWALVRALEGD-LDAI
AT1G08620.1 LHLSAAGCR-CSP-EKYSCLTHVKELCSCPWVTKYFLFRYDIDELNVLVEAVEGK-LSSV
AT2G38950.1 LYLSAVNCS-CSA-NRYSCLNHMRKLCACPCDRKSFLYRYTMDELNLLVEALEGKKLSSM
*::** .* **. :.:.* * .:*:* :: *: :*** **.*:**. . :

AT1G30810.1 KIWASKVLGI---------------------------------------------EHSDE
AT2G34880.1 KAWLSKVM-----------------------------------------------EGCSE
AT4G20400.1 DLWASKCRDQYPSQHPRAREYAY-----------------------LKSAPCIKSRGSSK
AT1G08620.1 YRWARQDLGLALSTDVSGSKMEIDEEGKVHKDPTPQTTALSGKDLQLKVTSKEVSKELEK
AT2G38950.1 FRWAGIDQ-----------------------------------------------KFCAS
* . .

AT1G30810.1 DQT-KTSSVISEEKKLK-------------------------------------------
AT2G34880.1 TQKGESSGIIVKEKQVQ-------------------------------------------
AT4G20400.1 VQQREQNNLQLVSERLQSDLTSNKE-----------------------------------
AT1G08620.1 TSKLSHVNLLLKEKEEQITSSHCMKPVKEETVCDSSDPNVSACQPSEGGIICMTAVKSAS
AT2G38950.1 PAT--TSSKPEEDKGKE-------------------------------------------
. .: :

AT1G30810.1 ----------------EGSFDLNID----------------LEMDYQEDVKEEASTSGG-
AT2G34880.1 ----------------EECFDLNG------------------ECNKSSEICEDASIM---
AT4G20400.1 -----------VQLKQDGDSDVNRHGH-------------ESERNHVHGITDKSAVTDVK
AT1G08620.1 GKKNSQSLPNDVILLSDDEYDIPRKRGSVRRDAISSGKKLEIRERPTHVLALEASAKIAA
AT2G38950.1 ---------------TDEVTPCNIT-----------------RKDVAAGTKDQTRVK---
: . .:

AT1G30810.1 ----------------------------------------------------ELTASENL
AT2G34880.1 ----------------------------------------------------DLAAYH--
AT4G20400.1 LGVGGKFDEKKISV----------ESQNPHSVSDVGCSELAKKVDGCLGGKDQNAATNRL
AT1G08620.1 PICQREGDSLRDTRNTISLPTNDQKTMRRDVPSSTSHAEVNAEATGLTQDICNRMATNSH
AT2G38950.1 ----------------------------------------------------ARSLADIL
.

AT1G30810.1 G----------------------------------------------------------V
AT2G34880.1 ------------------------------------------------------------
AT4G20400.1 S----------------------------------------------------------L
AT1G08620.1 GGGKPTSCKSKNSGGLAIVDVVDGTRSSSGTPSCSQNNSPDRFIRQKGPRIAKVVRRINC
AT2G38950.1 N-----------------------------------------------------------


AT1G30810.1 SVEPINLGFLIFGKLWCNKYAIFPKGFRSRVKFYNVLDPTRMSNYISEVLDAGLMGPLFR
AT2G34880.1 -VEPINLGFLVVGKLWCNKHAIFPKGFKSRVKFYNVQDPMRISYYVSEIVDAGLLGPLFK
AT4G20400.1 SVELLSSGSLVVKKLWCSKQAIYPKGFKSRVKFLSVLDPTNLTNYISEVLDAGLLGPLFR
AT1G08620.1 NVEPLSYGCVLSGKSWCSRRAIFPKGFRSRVKYINILDPTNMCFYISEILDAGRNSPLFM
AT2G38950.1 -VKDGNNDAKETLES-CSKKSNRPCDNDS---S-EANAPKKQKQ----------------
*: . . : *.: : * . * . * .

AT1G30810.1 VTLEESPDESFFNVSAQQCWEMVMRRVKDTST------SLGLPILPQFESINGLQMFGFL
AT2G34880.1 VTLEESQDESFSYASPQKCWEMVLLRVKEEIMR----RSNQKQDVHMLESIDGLKMFGFR
AT4G20400.1 VSVEDYPTENFSNVSAEKCWQMVTQRLKLEIIKKCDQPVSSLTSLQPLESINGLEMFGFL
AT1G08620.1 VYLESNPSEVFVHMSPTRCWEMVRERVNQEITKQHKAGKSDLPPLQPSGSPDGFEMFGYS
AT2G38950.1 ------------------------------------------------------------


AT1G30810.1 SPSIVQAIEALDPNHRLVEYWNHKNQTSS-----------DSKDHFISSNCSASLTKGKL
AT2G34880.1 SPFIVQATEALDPNHGQVEYWNHKNEKDSL----------EMKDCFMS-NSSQSLSKARL
AT4G20400.1 SPHVIKVVEALDPKHQLEEYWNQKAVKLFGAEPIK---EGEKDDTEKGGASDPSLDRDTR
AT1G08620.1 SPAIVQAIEALDVNRVCTDYWDSRPYSRPQVQFPANPLLREANTSGRSNVGNLQLNPGHH
AT2G38950.1 ------------------------------------------------------------


AT1G30810.1 FG--------VDLM---------------------------------------
AT2G34880.1 FG--------VDLN---------------------------------------
AT4G20400.1 LL--------RGLLKKATPEELVMMHGLLCGETRNTELKEELSTLVDKMEISP
AT1G08620.1 ISPTGINSILKVLFKKASMEELSSLQEVLS-ETNSDMVTELVKEEIQNRR---
AT2G38950.1 -----------------------------------------------------