CLUSTAL W (1.74) multiple sequence alignment


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 ------------------------------------------------------------
AT4G31610 ------------------------------------------------------------
AT2G24650 ------------------------------------------------------------
AT2G24690 ------------------------------------------------------------
AT2G24680 MAWNLAIITLVGKDGTKLEATLRRENRGLMCLGNGWKDLSISNGLKSGKSFTLELILENG
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 -----------------------------MAN-PL----------------LYSPINPQF
AT4G31660 -----------------------------MAD-PV----------------LQSPKNSHF
AT4G31640 -----------------------------MKN-PT----------------LFAPKSPHF
AT4G31650 -----------------------------MNN-PT----------------LFSPKSPHF
AT4G31680 -----------------------------MAN-AS----------------QLSPTNKHF
AT4G31690 -----------------------------MAN-AS----------------PLSPTNQHF
AT4G31620 -----------------------------MANHPL----------------SSSRSNRPF
AT4G31630 -----------------------------MAD-PL----------------IPSPTNKAF
AT1G26680 -----------------------------MADQSL----------------LHSPINPHF
AT4G31610 -----------------------------MAD---------------------PPHFSLF
AT2G24650 -----------------------------MAN---------------------SRIYPQF
AT2G24690 ----------------------------MMIQFSNNHDNNIEFQ-RRKKMKKNNPETETD
AT2G24680 TPMLSLVSTQSTSHKSQKRECSKHSEKESISAVPSKGKKNRKARSNREERRDSSSAIQNR
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 --------------------------------------------------------MEEN
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 -----------------------------MAPRFDFS---------DLWAKETRRGTPVV


AT2G24700 FQPLLPGFTNH---LDIPVAFFLKY--LVGTN-VGKTAELRSDASEMTWKVKIDGRR---
AT4G31660 FQPLLPGFDSY---LNIPVKFFSKR--IQGRN-EGRTVELRTDASEKTWQVKIQGRR---
AT4G31640 FQPILPGFKSH---IKIPVKFFSKH--IEGKH-EGNTVYLRSYPSRRTWKVKMEGHK---
AT4G31650 FQPLLPGFKSH---INIPVKFFSKY--IKGKH-EGKTVKLRSDSSKRTWKVKIEGHT---
AT4G31680 FKPLLPGFQRN---LNIPVKFFSEH--IEGKH-EGETVKLRADASKRTWEVKMDGNR---
AT4G31690 FQPLLPGFQSN---LKIPVNYFSEH--IEGKH-EGKTVTLRTDASERTWEVKMEGHR---
AT4G31620 FVRSLAGHTSN---LIIPDEFFTAH--LEGKT-GLTKLKLTSDASDRIWDVRLNGRR---
AT4G31630 FIIDLSGQKSN---PIIPTEFIWNH--FNGKI-QSTNMKLTSDASDRNWDVKLDGAR---
AT1G26680 FQPILTESRTH---LNIPVAFFSKH--VEGRNNQNKTVTLRSDASDKTWLVKMDGLK---
AT4G31610 QQKFRTGDKPF---LTLDADFL-----MNHT--K---VLLKSDASDKVWKVKLDGGR---
AT2G24650 FHTLVPSFHTH---LMIPEDFFSEY--IEGRS----VAELKLDFSDKSWEVKLSDRR---
AT2G24690 SSSDLSCFVAQTGALRLPMQFTRE----NGINKPGKIYLVGKDGSKWLANLLLENNRGRM
AT2G24680 FVTFTPEDIRD-CILILPSQFIKA----NGINNLGEITLLGQNRMKWFAYLLSMSKDGSL
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 CEDCMKWEEELYWTHFQTLHFTQLL--LPGFHNRLQFMLLFQFLHVFTFLCFPPAFN-LE
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 VKMENPNYSIV--EVEEPDSAFQPMEKSRGKNAKQVTWVLLLKAHKAVGCLTWVATVFWS


AT2G24700 -LSNGWEDFTIAHDL---RVG-DIVVFRQEGE-LVFHVTALGPSCCEIQ--YGEDTLEED
AT4G31660 -LTVGWKEFASAHDF---RVG-DIIVFRHEGS-LVFHVTALGPSCCEIQ--YVPSCNNQE
AT4G31640 -LTEGWKEFVEAHDL---RVG-DFVVFKHKGD-MLFHVTAIGPSCCEVQ--YAPSRSHDR
AT4G31650 -LTDGWKEFVEAHDL---RIS-DFVIFKHKGD-MFFDVTALGSSCWE-------------
AT4G31680 -LTEGWKEFVEAHDL---RIR-DFVVFRHEGD-MVFHVTALGPSCCEIQ--YPQSISHEE
AT4G31690 -LTEGWKEFVEAHDL---RIG-DFVVFRHEGD-MVFHVTALGPSCCEIQ--YPQSSRHEE
AT4G31620 -FAGGWDDFSAAHCL---RDD-DVLVFRLDVK-MVFHVTPSGRSFSQIR--TSSSSGDYD
AT4G31630 -FAGGWKDFSVSHSV---RDD-DLLSFRHDGG-MVFHVSPFGRSFSQIQLISSSTSDDDD
AT1G26680 -LTDGWEDFAFAHDL---RTG-DIVVFRLEGE-MVFHVTALGPSCCEIQYHTSSHNINDD
AT4G31610 -LSEGWEEFACDQKF---RDG-DVLVFKHHGD-EVFHVAVVSPSVSGDIRNASSSQVITE
AT2G24650 -ITDGWEEFVVANDF---RIG-DVVAFRYVGN-LVFHVSNLGPNYYEIE---HNDELPKE
AT2G24690 TLGDGWKSFVKANGL---KTG-DTYTFKLLWE-DTTPVLSLCFEEYNTDTRVGEES-SKE
AT2G24680 ALGSGWKGICEANGV---NTG-EAFTLEYIDEQETAHKTSQCVGEDDALWKVGLEMVLNS
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 IYTQMYQRGLSNFCF---FLS-KSVLCGFKSPKIANSSIKITTFCNLLQVIPRKFSTHCK
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 LLGSVKRRLSFTHPLGSERLGRDGWLFSAIKLFLVASLAILAFELVAYYRGWHYFKNPNL


AT2G24700 K-----------------------IEKLCGT-----------ENVS--------------
AT4G31660 N-----------------------ISNLSMK-----------QSIKTELESSLDEDKVNM
AT4G31640 N-----------------------EESDEIG-----------ESSR--------------
AT4G31650 -------------------------------------------SSR--------------
AT4G31680 G-----------------------EES---G-----------EVEI--------------
AT4G31690 G-----------------------EES---G-----------ENEI--------------
AT4G31620 S----------------------DDDDDEAG-----------DDDSD-------------
AT4G31630 DERTVF----------------DDDEDDDVG-----------DDDDNSISE--D------
AT1G26680 DRNDQINIASRNSSRVKKNPRKKVESSLDHSRFVAKVSAWCLSNDRLYIPLSFARLNGLN
AT4G31610 DTYIDVD----------------DVDDDDYGQ------D--DEDDDDDDDEGED------
AT2G24650 K-----------------------------------------------------------
AT2G24690 SLP--------------------AEPSSQEK---------IVKDDNNK------------
AT2G24680 SDLGPSR---------------CDIRDLPAPS---------STNDQGK------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 RKLPQIVTLK-----------SPSGVTYNVG----------VEEDD--------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 HIPTSKLEIQS------------LLHLFYVG----------WLSLRAD------------


AT2G24700 ---SKKKSLKR-------------------------------------------------
AT4G31660 GKFPRKKHVKKRI-----------------------------------------------
AT4G31640 ----NEKIIEEN------------------------------------------------
AT4G31650 ----KEKEIEEN------------------------------------------------
AT4G31680 ----SEREVEEN------------------------------------------------
AT4G31690 ----SEKEGEEN------------------------------------------------
AT4G31620 ---SKNISLKKK------------------------------------------------
AT4G31630 DFCSKKISSKKR------------------------------------------------
AT1G26680 KINSKKIYLQNEEGRSWKLVLRHDKSGMQTFVQSGWRRFCSENGIRQGQYTFKLVRKSAP
AT4G31610 --NIENISEKTD------------------------------------------------
AT2G24650 ----KAKTNSEE------------------------------------------------
AT2G24690 ---DESSTWKREGN----------------------------------------------
AT2G24680 TELARKKKVKRSN-----------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ---EKTMAFRFG------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 YIAPPIKALSKFC-----------------------------------------------


AT2G24700 -------------EAESAPDNSLDSCFVAT-VTGSNLKRDT-------------------
AT4G31660 ------------PEAEAKSFSSDKSCFVAH-VTDSNLREDT-------------------
AT4G31640 ------------VKTEPDQFSPDLTCFSQS-VTASNLTRDL-------------------
AT4G31650 ------------IETEPDQFSSDLTCFSQS-VTTSNLMRDS-------------------
AT4G31680 ------------LQKEYDQSSADLNCFSQS-VTHSNISNDL-------------------
AT4G31690 ------------VQKESDKSSSDLNCFSQS-VTHSNISRDA-------------------
AT4G31620 ------------SRFEAESSSSEKYCLLG--LTASNLRLNR-------------------
AT4G31630 ------------ARKETESSSDKSYLVAH--VTPSSLLRDN-------------------
AT1G26680 PVIRLCRAKAKPKQRSVAEYSSDHSCFEGS-VTPSSLRNDL-------------------
AT4G31610 ------------KRQEADSSSDHSGFITAR-VTRYSLLHDR-------------------
AT2G24650 ------------ADAVSSSSSADKSCFMAI-ITALDLTTDT-------------------
AT2G24690 ------------HLRCKDSTSPSQNCTLTVTITPDSLEHGR-------------------
AT2G24680 ------------TEIEADASSSDNSCFVAL-VTASNLRKDALVTVCIFSNLYSNFSLVFI
AT3G06220 -------------MASGDVLPRFYTVFLSC-VSSN---SLK-------------------
AT3G53310 ------------MADDSELYPRFFKVFLVESASES-------------------------
AT3G46770 ------MEENSSKKKLSETMSIQDTVLKFFRVYIPNQTADD-------------------
AT4G33280 ---------WDKFVKDHSLEENDLLVFKFHGVSEFEVLVFDG------------------
AT5G09780 --------MASNPDFLWCKEERKQESFFKVLKRSDMSSEDT-------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 -----------IVLFLVQSVDRLILCLGCLWIKFKKIKPRID------------------


AT2G24700 ----------------LYIPKEFALSNGLMN-KYQIVLMNE-EGESWKIDLRR-EAYNYG
AT4G31660 ----------------LFLPRKFDRSDGLIKGSNKIVLMNE-EARTWTLILKF-RNSSR-
AT4G31640 ----------------VGIPRDFAKRYGLNIGRHEIVLMDE-EGNTWESEVKS-YKSGR-
AT4G31650 ----------------VGVPRDFAKRYGFNIGRHEIVLMNE-EGKPWESEVIS-YKSGK-
AT4G31680 ----------------VTLPRDFAKRNGLDKGMHEIVLMNE-EGKSWESEVRS-RMSGQ-
AT4G31690 ----------------VSVPRDFVKRSGFSKGRHEIVLMNE-EGKSWESEVKS-YMSGA-
AT4G31620 ----------------VSFTKHFSRANGLTKRCCMIDLMNL-SGESWTLGLRHNKRTGQ-
AT4G31630 ----------------MCVLSKFARSNGLDRRECEIDLRDE-HEKSWTLLLRHNKKTGQ-
AT1G26680 ----------------LYLPRSFVNSNRLDKRCSEIVLKNE-QGVKWPLVLKR-FKSVT-
AT4G31610 ----------------LDLSRNFTLLFGGHQKTCEIDVVDE-QGRRWTMKLAKNISSGV-
AT2G24650 ----------------LYLPLHFTSANGLTRKNREIILTDG-GERSRVLDLRFDESSGT-
AT2G24690 ----------------LRLPLQFMTENSMNK-PGEITLLGT-DGAKWMASLLL-EKKGR-
AT2G24680 SILFGESVFSRLLYLCLYLPQDLTSSVGLERKYREIVVTDERERRSWALDLRFNKSSDT-
AT3G06220 -----------------LIPRSYYEHLPRRLPKTAILTGTG--GRVWKVAMMS--KREQ-
AT3G53310 ----------------LMIPLPFMAFLADPLPKTVKLQGLG--GKLWTVSLKK--ISGA-
AT3G46770 ----------------MNLPLVSDKISGKPLPRKVTVKSVS-SGNIWRMEMKA--NGNT-
AT4G33280 ------------QTLCEKPTSYFVRKCGHAEKTKGIIDFNATSSRSPKRHFNPDDVETTP
AT5G09780 ----------------RAIPYDFVINFSDNELSGDMKFRVQ-WGNSWKVKISK-NPRFY-
AT1G49480 ----------------MQMDSAQNQFNKRARLFEDPELKDA--KVIYPSNPESTEPVNKG
AT2G24630 ---------------EEHFRNDDFEGSGSEYPMVLVQIPMCNEREVYEQSISAVCQLDWP


AT2G24700 -RFYMRRGWRSFCIANGKKPGDVFAFKLVKNEETPMIQLFPMT------------IEDLD
AT4G31660 -TFYMRGGWTSFSMSMGLNLEIPSRLN---------------------------------
AT4G31640 --VFIAGGWTSLCTANKLEVGDSCTFKLLRNPKIPVFRLCSR---------------PKA
AT4G31650 --VIVAGGWKSLCTESKLEVGDSCTFKLLHNAKMPVFRLCSKL--------------PKA
AT4G31680 --VFIVGGWKSLCSENKLKGGDSCTFKLLQNAKTPVFQLCSRIGESRFVKLTPTLNSLEI
AT4G31690 --VYLVGGWTTFCTENKLDVGDSCTFKLLQKAKTPVFQLCSRT----------------K
AT4G31620 --AFIRGRWRSFCHANELKPGSFYRFKLVRNGTRPLLQLC------------------FK
AT4G31630 --AFMRGGWRSFCRNNGIKAGSICRFKLVQSGIKPVLQLCPN----------------AS
AT1G26680 ---YLPKGWTSFCQVNRIKAGDSFKFKLVGTWKKPVLSLCPTQSNNHKTPLECS-EGNKS
AT4G31610 --FYIRLGWGNFCCANGLTQGDLCKFKLFQNEERPVLWLCPQ------------------
AT2G24650 --FYISRGWRNFCDENGQKAGGFFLFKLVGKGETLVLSFCPTESING--------EENIT
AT2G24690 --MSLGKGWKDFAKANGLKTGDSITLEPIWEDRTPVLSIKSSSGKGQS-------EFSKE
AT2G24680 --FYISRGWRSFCDENGKKPGGVFVFKLVGNRETPVLSFCSTES--------------IN
AT3G06220 --VYLARGWENFVADNELKDGEFLTFVFDGYKSYEVSIYGRGS------------CKETR
AT3G53310 --AYLTRGWPKFAEEHELKNGEFMTFVYDGHRTFEVSVFDRWGS-----------KEVRA
AT3G46770 --VFLRDGWKKIVKDENVTEPIFLEFEFDGYGVFHFCVYEYGSMCKR---------MRSP
AT4G33280 NQQLVISPPVDNELEDLIDIDLDFDIDKILNPLLVASHTGYEQEEHIN------SDIDTA
AT5G09780 --FMEKSGWEKFVIDNALGDHEFLTFTHKGQMSFTVKIFNKDGKEMMQPP--QSRASFAS
AT1G49480 --YGGSTAIQSFFKESKAEETPKVLKKRGRKKKNPNPEEVNSSTPGG--------DDSEN
AT2G24630 KDRLLVQVLDDSDDESIQELIRDEVTKWSQKGVNIIYRHRLVRTGYKAGN--LKSAMSCD


AT2G24700 KLQSLPRHKIRKTEAAPSSPDLSSFVATVTAS-----NLSRDRLYLPKTFIMSNGL----
AT4G31660 ------------------------------------------------------------
AT4G31640 GAEARPHKRSRVQSSSGGSRQKHDVRQKLDEE-----GGPSRCTRSSNKATGDQEK----
AT4G31650 GAEARPLKRARVQRWSQESRSKHDVREKIAEE-----GEPSRRNRTSNKSTGDQGK----
AT4G31680 GKQHLPVSFTKGNGLIHPGEIILVDKDRVEWS-----MKLQVDNRGGMHIFGGND-----
AT4G31690 ---HLPLSFTKVNGLINPGKIILVDKDRAEWS-----MMLKVDSRGAVYIIGGND-----
AT4G31620 VIPQGNCSNSKANGKANVSEKYSREDGSAST------KQNKFLTVTLKHYMIQSGQ----
AT4G31630 SIPEGNS--SKARKKRNVSEIEGDEIESENCSETIPLNQNKILTFDLKPYVFRSCQ----
AT1G26680 EESEEDCLEVKKKKYWSRCRASVENMDDDQTN-IGNSSRKKRVSKNPREKVESSSD----
AT4G31610 -----ESGNGRKEKRTFDEVSKGKEKKTPSP------FLIVKY-TPSRETTGQLS-----
AT2G24650 REDSKDECSSLDSLMNIVEKKKYIPKPRGSPYSSYSPSHKQFVTFTLPPDYARIG-----
AT2G24690 SLSIKPSSGNMTKKVENNREASRKYPPRSRES-SSAIQNQFMALTPLRDIVSQVAH----
AT2G24680 -DGTQGHKNNKYNCMELKSKKKRMRCRDSTSP-----SQNRFMTLTLTHDNLIKSR----
AT3G06220 AVVHVEEISDESESDNDSLGSLVDVTPMPAEE----NSDDTEGDNDSCDSVVDVTP----
AT3G53310 EIQAIPLSDSDSDSVVEDEKDSTDVVEDDDDE-DEDEDEDDDGSFDEDEEISQSLYPIDE
AT3G46770 MEKEVIKVDSEEDVLVGNEESTKGLEESPRRG---GTSRRRAKLKTKSHKIYEHLD----
AT4G33280 SAQLPVISPTSTVRVSEGKYPLSGFKKMRRELSNDNLDQKAAGSNKKALSLAKRAIS---
AT5G09780 SSRVKTEQDVKREEEVLVSSDSRSRGPTTAAETNRGGSYKRKLNFGKKKAEETQTYKR--
AT1G49480 RSKFYESASARKRTVTAEERERAVNAAKTFEP------TNPYFRVVLRPSYLYRGC----
AT2G24630 YVEAYEFVAIFDADFQPNSDFLKLTVPHFKEKPELGLVQARWAFVNKDENLLTRLQ----


AT2G24700 -LKKFQMCLMNEEGESWT--------IDVKHEAHTGRFLTIRGWRRFCVANGKKPGDLLK
AT4G31660 ------------------------------------------------------------
AT4G31640 -LQQTQSCFIFDHVAK---------------VKQS-----VED---TLNSIRRFRAKLET
AT4G31650 -LQQTQSCFIFDHVAKSLPRNFV---RSDGLIKGSNKIVLMNEGARTWTLILKFRDSRRS
AT4G31680 ---WKSFCAANEVGAG-----------------ESLTLELIRGGLSP-LFKFFSKIEQPS
AT4G31690 ---WKSFCAANEVGAG-----------------ESLALELIQGGVLLNQITTCFQMEQPS
AT4G31620 --LRLRRSFVRENGIK-----------------EAEEIILVDKNGVEWPSYVSSSKQRRE
AT4G31630 --FFLPASFARENGIV-----------------EAGEVTVLNKDGIEWKSHLVNIKGRDQ
AT1G26680 -HSSFVGSVNPSSLYKDQLYLPRNFVSSNFLDKRCSEIVLKNERGEKRTLVLKHFKKDLT
AT4G31610 ----LPVSFTRNNSIN-----------------KTGEVILLNQDGRKWSSYLQITGLGRG
AT2G24650 -KLSLSAPFVRENGIN-----------------KPGEICLLDKHGRKWLTSLLLDSKGTM
AT2G24690 -DLSIGEVINFRHKGDNMLRVSDLGSNCCGVQDLLAPSSNYDHDNIKPPSKKKVKKNNPE
AT2G24680 --RQLPLPFMRENGLV-----------------KPGIINLLGKDGTKWEVNLRREANGTM
AT3G06220 -MPVEEISDASDSDYY--------------------------------------------
AT3G53310 ETATDAAVFEGNLDVEALTNPHFPTTLKNRIYELLIPANVVKDNNLEFGSSIKYIDGEGT
AT3G46770 -NKLNPSFPVDMTQNR-----------------TRIPSLLIKDYNLTFPNMVIMRDKIGI
AT4G33280 --PDGFLVFMKRSHVVSKCFLTIPYKWCVKNMLITRQEVVMQVDQTKWEMKFNIFGARGS
AT5G09780 -TERTQNSKRTERVVSKERVYAGEPSSSVAGFKIFISKSYIKSLAIPKPFGNYMPKEKTR
AT1G49480 -IMYLPSGFAEKYLSG------------------ISGFIKLQLGEKQWPVRCLYKAGRAK
AT2G24630 -NINLCFHFEVEQQVNGVFLN----FFGFNGTAGVWRIKALEESG-GWLERTTVEDMDIA


AT2G24700 F-----------KLVHNEETPVLQLLPLNSEDLHKLNPSNDT-------RHGQSLKVTKK
AT4G31660 ------------------------------------------------------------
AT4G31640 ----------------------KEHNLEA------LLQETKT-------KL---------
AT4G31650 F-----------YSRGGWRSFCRENGLKPGDSVTFKLESSNT-------KTPLLLFSIAE
AT4G31680 --------------------FEAEDRRHKRARVHNGSQETDK------------------
AT4G31690 --------------------FKAEDGRHKRARVQNRSQETDK-------GAETSRASTMG
AT4G31620 F-----------YMAHGWIRFCEANKLK-TGETFTLEFVRGE-------GTTPMLKFCSE
AT4G31630 F-----------YN-RGCQDFFVANGVKNVGDPFTLEVIRG--------GPSPILKICSK
AT1G26680 F-----------LK-KGWTSFCQVNRIKAGDSFKFKLVGTWN-------KPVLSLCPTET
AT4G31610 AG------SEWFYLRRGWREMCEANGVGVNDS--FKLELVWE-------GANPMFKFCSK
AT2G24650 S------------LGKGWKEFVKANSLETG----FTLKLIWE-------ETTPVLSLCSP
AT2G24690 ME------ADYLSDHSCFVSHVTTSSLHTNALSLEVKESLPI-------EPSIKPNISED
AT2G24680 Y------------LGKGWKDFTIANGLKTGES--FTLEAVLE-------NGTRMLSLVST
AT3G06220 ------------------------------------------------------------
AT3G53310 LVGLRGKWADKRVCFKGWDRICRRNRLKKHQDTVECELLHDD-------QKMVHSIRVHV
AT3G46770 LKRRIVIWKNRSVYLNGIGSIIRRNHVKPGNEVVFELKMVNG-------YHGLVHEIKVH
AT4G33280 G-----------GISTGWKKFVQDNNLREGDVCVFEPANSET-------KPLHLNVYIFR
AT5G09780 VKIHHP--DGEKTWKVVFVVKERGQIFSGGWKRLCKEYPVVF-------GDTCKFTLITP
AT1G49480 FS-------------QGWYEFTLENNIGEGDVCVFELLRTRD-------FVLEVTAFRVN
AT2G24630 VR----------AHLHGWK-FIYLNDVKVLCEVPESYEAYKKQQHRWHSGPMQLFRLCLR


AT2G24700 EFLGMEAT----------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 SKSASTKD----------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 PKLEITEK----------------------------------------------------
AT4G31620 AKIEQ-------------------------------------------------------
AT4G31630 VKQAASSDGH---------------KTADRKPR---------------------------
AT1G26680 NYHKTPLACS---------------EGNKSEES---------------------------
AT4G31610 IENHEYKGKG---------------NQRTRKKR---------------------------
AT2G24650 ESNSDREQEE---------------ISKAIEKH---------------------------
AT2G24690 DNNKEEDIIE---------------ENSSFEREKNHWICIDSISSSQNRFLTLTITPDSL
AT2G24680 QSTSDRNQQGECLKDSEKESNSTEPSSGKRKAMINRGVRRKSFPASQNRCVTLKLTHDNL
AT3G06220 ------------------------------------------------------------
AT3G53310 LRRDA-------------------------------------------------------
AT3G46770 IIKA--------------------------------------------------------
AT4G33280 GEETERTNNVDPVYTISE------------------------------------------
AT5G09780 LELLLVVSKP--------------------------------------------------
AT1G49480 EYV---------------------------------------------------------
AT2G24630 SILTSKIAMWKKANLILLFFLLRKLILPFYSFTLFCVILP--------------------


AT2G24700 ---------------ENEFLG-EEVYCND--------SFKASEKDTLPFAEPINEDI---
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ---------------RTRFLT-LTVTPSS--------IRSSRLYLSKKFISVNKMER---
AT4G31680 ---------------GEPSRA-TKMGP----------ELEKREKTAEKGEPSRASNK---
AT4G31690 ---------------GEPSRA-STMRP----------KVEIREKIAETGEPSRASNK---
AT4G31620 ----------------EEAP----EERGT--------PLPKRARVSAEVGHSRRTQAPN-
AT4G31630 --------------MTDQAPL-AEEQTDN--------RVEKRAQVTEEGGPSRSTRA---
AT1G26680 --------------EEEGTEDKNTSQDCL--------EVKKRKYWSTCRASAENIDDDQ-
AT4G31610 --------------ACETAPQPRNVKKTP--------RLGVEGPVYQVDEERGHTQVSN-
AT2G24650 --------------SLFIDPSNRDKISNN--------DKEENMSWERKKDHLKSRDS---
AT2G24690 KHGRLRLPLQFMIENSMNKPGEITVLGKDGAKWLVSLLLERRGRMSLDASSGQETREAE-
AT2G24680 IKSRRYLPLSFTRDNGLDKPGMIFLLGKTGRKWEANLLREASGRIVLTGKGWKEFAMANG
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ---------ITMFVPEAELPIWVICYVPIFMSLLNILPAPKSFPFIVPYLLFENTMSVT-


AT2G24700 -----------------------------RQGQCSQTIKQE-------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 -----------------------------AGGKKITLLDKN-------------------
AT4G31680 -----------------------------SSGKQGNLQKTQ-------------------
AT4G31690 -----------------------------SSGIEGNLQHTK-------------------
AT4G31620 -------------------------K---SSDDPKILQRKQPL-----------------
AT4G31630 --------------------------------DPGNLQQK--------------------
AT1G26680 -------------------------TNIGNSSKEKRVKKNPVK-----------------
AT4G31610 -------------------------R---TNTISGNLQRLLP------------------
AT2G24650 -----------------------------TLSSQKQFVTITIT-----------------
AT2G24690 -------------------------KNREESSSLWELEKRTYCP----------------
AT2G24680 LKSGELFTLEAILEKGTPMLSLVNTQSTNYRSQQGECSRDSEKESSICAEPSRGNKKWKA
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ----------------------------KFNAMVSGLFQLG-------------------


AT2G24700 -----YVSTEEKNSTSQNRFVTLTLTHSSKLNLPFEFMKRNGI--KKAGKITMVDRYDAK
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 -----GEEWPVTLLMDKRYTRMVLGSGLREFCNAIGVKAYESV--VLELVWEETTTLPMF
AT4G31680 -----ACSV-TDHVAKVKESVVDTLTSIRRFQAELETMEQK-----LEDSLQEINKLS--
AT4G31690 -----PCSVKTDQLAKVKESVVDTLTSIGRFQAELETMKRK-----LEDSLQELN-----
AT4G31620 -----QPCSFSDQAKKVKQSIVNILTGIKRFRSELELKERN-----LEAALLEIDALGDK
AT4G31630 -----QPCSISDHVKKVKQSIVDTLTDVRRFQSELKVKEQN-----LEASLQEIDALG--
AT1G26680 -----KAESSSDHSSFVANVTASSLN-YDRLYLPLSFVSSNGLDKMNGKEIVLLNEEGLS
AT4G31610 -----PSCSVSDQVANVKQGIVDSLNTVRQCRTELETSEQN-----LQASLLAIDALGER
AT2G24650 -----PSSDRLVSLSNDSCLVVVSLLYFDMRLPKVFTRENGIN---KPGRITLLGKDGIK
AT2G24690 -----RKRDSSSDVKNRFLTLTLAPEDVKDGNLHLPCQFMRINGINKPGQITLLGRGGMK
AT2G24680 TNNRKERRDSSSAIQNRYVTLTLTPEDVRACTLILPSQFMKANGINKLGKKTLLGQNRKK
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 -----SSYEWIVTKKAGRSSESDLLALTDKESEKMPNQILRGVSDSELLEISQVEEQKKQ


AT2G24700 WR-TSLLMDKIGTMSLGRGSKGFCEVNGVEMNESFILELI-WEDTVPLLKFCSKV-----
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 KF-CSKIKT---------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 VSEINKILK---------------------------------------------------
AT4G31630 -----MI-----------------------------------------------------
AT1G26680 WKFNLKYNQAGKHTYVRPGWSRFCDANGMSQGQQFTFKLV-QKHGPPVMYLSLSEHRPKS
AT4G31610 IWGISKILSSNLV-----------------------------------------------
AT2G24650 QQTNLLFDKANGAMSLGHGWKDFVKDNGLKTGDSFTLKLI-WEDQTPVLSLCPADCSIDR
AT2G24690 WF--AYLLSGDGTVVVGNGWKGFCEANGVMLGETFVLEFI-PKDDTNHVFKFYTK-----
AT2G24680 WF--AYLLSKSGFVALGSGWKGFCEANGVKTGESFNLEYIDEQDTTPVFKFCSNSVEYVK
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 PVSVKKTNKIFHKELALAFLLLTAAVRSLLASQGVHFYFLLFQGLTFLLVGLDLIGEQMS


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 ESSSHRSYFVGSVTASSIKKDKLYLWKSFVSSNGLDKGCKKIILKNKWGREWKLVLKHYK
AT4G31610 ------------------------------------------------------------
AT2G24650 EAGGGRSETNQKKSLPIEPSTCKKIRKDVNIKDDNSKEKNDKEESKSVDGERKYLRGTYL
AT2G24690 ------------------------------------------------------------
AT2G24680 FTSLP-------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 SNCFTIIKRGWTSFCQGNGLKAGDSFKFKLVGTGEKPVLSLCPAESSHEKIPLECPEGID
AT4G31610 ------------------------------------------------------------
AT2G24650 TPSSQKHFVTLTITPSSIKKDRLILSPQFARKNNIDKPGMIYLLDTDGTKWLISLQRDKK
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 DVNSLSSNPSSGDDSSRSEESEEENMEDKNISQDCLETKKRKYCSSSSYSQNRFVTLTLT
AT4G31610 ------------------------------------------------------------
AT2G24650 GTMSLGKGWKEFAEANDFKLGESFTMELVWEDTTPMLSLLRTEFRSSKANEKESISSEHK
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 RSAFQTYKLVSFFNNYASRLS---------------------------------------
AT4G31610 ------------------------------------------------------------
AT2G24650 TRESSPTIKNRIVTPALTPEDVKACKLVTSSNYSCFSEILSAQFARENNINQPGTIYLLD
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 ------------------------------------------------------------
AT4G31610 ------------------------------------------------------------
AT2G24650 TDGRKWLTTVKRDKKGTMSLGKGWKEFADTKDLKSGDSFTMELIWEDTNPVLSLLRTKFS
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 ------------------------------------------------------------
AT4G31610 ------------------------------------------------------------
AT2G24650 SSKSNKEESIFLEPKSRDSSSPTIVNRFVTLALTPEDVTACKLILPSQFMKANGINNKLG
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 ------------------------------------------------------------
AT4G31610 ------------------------------------------------------------
AT2G24650 KITLLGENGVEWPGYMLSLDGTLALGNGWEGFCEANGVKLGQTFTLEFVNEQDTTTTPRI
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 ------------------------------------------------------------
AT4G31610 ------------------------------------------------------------
AT2G24650 PVAFFLKNIEGRYEQKTAELRSDASKITWEVKIDGQRLTDGWKEFALSHDLRIGDIVVFR
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 ------------------------------------------------------------
AT4G31610 ------------------------------------------------------------
AT2G24650 QERDMSFHVTMLGPSCCEIQYGSCSDEERNLEKKKNPNGEAKSSSLDPSCFSANVAPSSL
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 ------------------------------------------------------------
AT4G31610 ------------------------------------------------------------
AT2G24650 RYDLMLFPMGFVRENGVVGSGKIVLMNEKGRSWNFNLRQKPSCGTVYVRGGWVSFCDANG
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 ------------------------------------------------------------
AT4G31610 ------------------------------------------------------------
AT2G24650 LQAGDIYTFKLIKRGGTLVLRLLPKGAESCSLDPSCFVANVAPSTLRYDTLYLPKRFMRE
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 ------------------------------------------------------------
AT4G31610 ------------------------------------------------------------
AT2G24650 NGVDKRRGEMILMNEKGKSWTLDLKLKKSCGTSLIRRGWRSFCSANGLRAGSIITFKLIK
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 ------------------------------------------------------------
AT4G31610 ------------------------------------------------------------
AT2G24650 KSGTLVLCLLSNEPEEEVCSEANEVESLSTDQESHEESSHNEKISRRKEKKGRMIWKASS
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 ------------------------------------------------------------
AT4G31660 ------------------------------------------------------------
AT4G31640 ------------------------------------------------------------
AT4G31650 ------------------------------------------------------------
AT4G31680 ------------------------------------------------------------
AT4G31690 ------------------------------------------------------------
AT4G31620 ------------------------------------------------------------
AT4G31630 ------------------------------------------------------------
AT1G26680 ------------------------------------------------------------
AT4G31610 ------------------------------------------------------------
AT2G24650 SPSENRFVTLNLTPYNILRSALRLPIPFTRMNGINEETKMTLLDKHGMKWLTTLRLVDYK
AT2G24690 ------------------------------------------------------------
AT2G24680 ------------------------------------------------------------
AT3G06220 ------------------------------------------------------------
AT3G53310 ------------------------------------------------------------
AT3G46770 ------------------------------------------------------------
AT4G33280 ------------------------------------------------------------
AT5G09780 ------------------------------------------------------------
AT1G49480 ------------------------------------------------------------
AT2G24630 ------------------------------------------------------------


AT2G24700 --------------------------------------------------
AT4G31660 --------------------------------------------------
AT4G31640 --------------------------------------------------
AT4G31650 --------------------------------------------------
AT4G31680 --------------------------------------------------
AT4G31690 --------------------------------------------------
AT4G31620 --------------------------------------------------
AT4G31630 --------------------------------------------------
AT1G26680 --------------------------------------------------
AT4G31610 --------------------------------------------------
AT2G24650 RKRLGMVGGWKGFIQANGVKANESIMLELIWEEETSCVLKFCSKVKLAIK
AT2G24690 --------------------------------------------------
AT2G24680 --------------------------------------------------
AT3G06220 --------------------------------------------------
AT3G53310 --------------------------------------------------
AT3G46770 --------------------------------------------------
AT4G33280 --------------------------------------------------
AT5G09780 --------------------------------------------------
AT1G49480 --------------------------------------------------
AT2G24630 --------------------------------------------------